PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g57940.1.p
Common NameBRADI_2g57940, LOC100822835
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 532aa    MW: 57380.9 Da    PI: 6.1385
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g57940.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS351.21.7e-1071565301374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvsel....ykal.ppsetseknsseelaalklfsevs 88 
                       lv+lL++cAeav+ +d ++a +lL +l+  a  +g+++qR+a++f+++La rla   +      + a+  p+++s+ + + +  al + +ev+
  Bradi2g57940.1.p 156 LVQLLVACAEAVACRDRAQAASLLRELQAGAPVHGTAFQRVASCFVQGLADRLALAHPPAlgpaSMAFcIPQSSSSASCAGRGEALAVAYEVC 248
                       689**************************************************98555431111223324444444557888889999***** PP

              GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGl....QWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                       P+l+f+h++aN  Ilea+ege++vH++D++++ Gl    QW aLl+ La+R  + p+++R+Tgvg+    + ++++++g  L+ +Aeelg+ +
  Bradi2g57940.1.p 249 PYLRFAHFVANASILEAFEGESKVHVVDLGMTLGLdrahQWRALLDGLAARGvARPARVRVTGVGA----RVDAMRAVGLELEAYAEELGMCV 337
                       ******************************999866666*************56666*********....9********************** PP

              GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                       ef++ + ++le+l++++L v+ +Ea+a+n+vl+lh +++es    +   +vL+++++l Pk +v+veq+a hn++ Fl rf+eal+yy+alfd
  Bradi2g57940.1.p 338 EFRA-IDRTLESLHVDDLGVEADEAVAINSVLELHCVVKESRGALN---SVLQTIRKLAPKAFVLVEQDAGHNGPFFLGRFMEALHYYAALFD 426
                       ****.799******************************88877777...8******************************************* PP

              GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlg 361
                       +l+a lpr +  r+ vE++ +g ei+nvv cega+r+erhe++ +Wr+r+++aGF+++p++   a++a+  l++ + + gy+v ee+g+lvlg
  Bradi2g57940.1.p 427 ALDAALPRYDARRARVEQFHFGAEIRNVVGCEGAARVERHERADQWRRRMSRAGFQSMPIKM--AAKAREWLEENAgGTGYTVAEEKGCLVLG 517
                       ************************************************************75..4567777777777**************** PP

              GRAS 362 WkdrpLvsvSaWr 374
                       Wk++p++++S+W+
  Bradi2g57940.1.p 518 WKGKPVIAASCWK 530
                       ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.473130511IPR005202Transcription factor GRAS
PfamPF035145.7E-105156530IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MGMSPSPFTT SYCLTEQDAS ICTETQELDY HHSYYYGIED VSLDEVELEL AASSGRAHKA  60
TKVDYHSSPY HISWPPPPQQ ASADVESSRV RKKQFRDVLE SCKQKVEAME AMEQHSPPLS  120
GGGVGFQDQQ GDSGHGVAVG GEGSSNSGGG TDGMRLVQLL VACAEAVACR DRAQAASLLR  180
ELQAGAPVHG TAFQRVASCF VQGLADRLAL AHPPALGPAS MAFCIPQSSS SASCAGRGEA  240
LAVAYEVCPY LRFAHFVANA SILEAFEGES KVHVVDLGMT LGLDRAHQWR ALLDGLAARG  300
VARPARVRVT GVGARVDAMR AVGLELEAYA EELGMCVEFR AIDRTLESLH VDDLGVEADE  360
AVAINSVLEL HCVVKESRGA LNSVLQTIRK LAPKAFVLVE QDAGHNGPFF LGRFMEALHY  420
YAALFDALDA ALPRYDARRA RVEQFHFGAE IRNVVGCEGA ARVERHERAD QWRRRMSRAG  480
FQSMPIKMAA KAREWLEENA GGTGYTVAEE KGCLVLGWKG KPVIAASCWK C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-531565304375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564863.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLI1HUB70.0I1HUB7_BRADI; Uncharacterized protein
STRINGBRADI2G57940.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56403354
Representative plantOGRP70521119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.18e-57RGA-like 1